TNFAIP8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TNFAIP8 Polyclonal antibody, PBS Only (15790-1-PBS)

• 

  WB analysis using 15790-1-AP (same clone as 15790-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15790-1-AP (TNFAIP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15790-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 15790-1-AP (same clone as 15790-1-PBS)

  WB result of TNFAIP8 antibody (15790-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-TNFAIP8 transfected K-562 cells. This data was developed using the same antibody clone with 15790-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 15790-1-AP (same clone as 15790-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 15790-1-AP (TNFAIP8 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15790-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-13 using 15790-1-AP (same clone as 15790-1-PBS)

  PC-13 cells were subjected to SDS PAGE followed by western blot with 15790-1-AP (TNFAIP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 15790-1-AP (same clone as 15790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer slide using 15790-1-AP (TNFAIP8 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 15790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 15790-1-AP (same clone as 15790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis slide using 15790-1-AP (TNFAIP8 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 15790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 15790-1-AP (same clone as 15790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer slide using 15790-1-AP (TNFAIP8 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 15790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 15790-1-AP (same clone as 15790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis slide using 15790-1-AP (TNFAIP8 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 15790-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TNFAIP8 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15790-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

GG2 1, Head and neck tumor and metastasis-related protein, MDC 3.13, MDC-3.13, NDED

---

Product Information

15790-1-PBS targets TNFAIP8 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8491

  Product name: Recombinant human TNFAIP8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC007014

  Sequence: MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

• Full Name: tumor necrosis factor, alpha-induced protein 8
• Calculated Molecular Weight: 198 aa, 23 kDa
• Observed Molecular Weight: 19-23 kDa
• GenBank Accession Number: BC007014
• Gene Symbol: TNFAIP8
• Gene ID (NCBI): 25816
• RRID: AB_10792805
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95379
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNFAIP8 (tumor necrosis factor, alpha-induced protein 8), also called SCC-S2/GG2-1/NDED, is associated with enhanced cell survival and inhibition of apoptosis. The induction of TNFAIP8 by TNF depends on the activation of NFκB. TNFAIP8 suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. TNFAIP8 is expressed in adult spleen, lymph node, thymus, thyroid, bone marrow, and placenta, and in fetal liver, lung, and kidney at high levels, also expressed in various tumor tissues and all cancer cell lines tested. There are four major isoforms of TNFAIP8.