TIPE2/TNFAIP8L2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TIPE2/TNFAIP8L2 Polyclonal antibody (15940-1-AP)

• Featured Product
• KD/KO Validated

TIPE2/TNFAIP8L2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 15940-1-AP Copied!

Publications (43)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

TIPE2, Inflammation factor protein 20, TNF alpha-induced protein 8-like protein 2, TNFAIP8 like protein 2, TNFAIP8L2

• 

  WB analysis using 15940-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15940-1-AP (TIPE2/TNFAIP8L2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse cerebellum using 15940-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 15940-1-AP (TIPE2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse small intestine using 15940-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 15940-1-AP (TIPE2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat lymph using 15940-1-AP

  rat lymph tissue were subjected to SDS PAGE followed by western blot with 15940-1-AP (TIPE2 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat spleen using 15940-1-AP

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 15940-1-AP (TIPE2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse spleen using 15940-1-AP

  IP result of anti-TIPE2/TNFAIP8L2 (IP:15940-1-AP, 4 ug; Detection:15940-1-AP 1:2000) with mouse spleen tissue lysate 1400 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 15940-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 15940-1-AP (TIPE2/TNFAIP8L2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 15940-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 15940-1-AP (TIPE2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 15940-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 15940-1-AP (TIPE2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 15940-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 15940-1-AP (TIPE2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 15940-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor slide using 15940-1-AP (TIPE2 antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 15940-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor slide using 15940-1-AP (TIPE2 antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15940-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TIPE2/TNFAIP8L2 antibody (15940-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of RAW 264.7 using 15940-1-AP

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using TIPE2/TNFAIP8L2 antibody (15940-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of THP-1 using 15940-1-AP

  1X10^6 THP-1 cells were intracellularly stained with 0.4 ug Anti-Human TIPE2/TNFAIP8L2 (15940-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TIPE2/TNFAIP8L2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: THP-1 cells, mouse small intestine tissue, mouse cerebellum tissue, rat lymph tissue, rat spleen tissue, RAW 264.7 cells, mouse spleen tissue
• Positive IP detected in: mouse spleen tissue
• Positive IHC detected in: human lymphoma tissue, human ovary tumor tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, RAW 264.7 cells
• Positive FC (Intra) detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15940-1-AP targets TIPE2/TNFAIP8L2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7964

  Product name: Recombinant human TNFAIP8L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC063014

  Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL

• Full Name: tumor necrosis factor, alpha-induced protein 8-like 2
• Calculated Molecular Weight: 184 aa, 21 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC063014
• Gene Symbol: TIPE2
• Gene ID (NCBI): 79626
• RRID: AB_2204663
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P589
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIPE2 (TNF-α-inducible protein 8-like 2, or TNFAIP8L2), a negative immune regulator, is essential for maintaining immune homeostasis. TIPE2 shares considerable sequence homology with members of the tumor necrosis factor-α-inducible protein 8 (TNFAIP8) family, which are thought to regulate cellular and immune homeostasis. TIPE2 acts as a negative regulator of Toll-like receptor and T-cell receptor function and is preferentially expressed in lymphoid tissues. TIPE2 plays an essential role for a signal transduction pathway that links inflammatory immune response to specific conditions after cerebral ischemia

Publications

What published studies show

The anti-TIPE2 polyclonal antibody (Cat# 15940-1-AP) has accumulated 43 citations across journals including Nature Immunology, Science Advances, Journal of Experimental Medicine, Journal of Biological Chemistry, Frontiers in Immunology, Autophagy, Human Molecular Genetics, and Journal of Immunology. Research fields span immunology (innate/adaptive immunity, immune checkpoints), oncology (colorectal, gastric, pancreatic cancer), neurology (stroke, neuropathic pain), inflammation, infectious disease, asthma, and metabolic disorders.

Automatically generated from the 43 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP,IF	Nat Immunol; Direction of leukocyte polarization and migration by the phosphoinositide-transfer protein TIPE2.; Authors - Svetlana A Fayngerts ; KO Validated
human	WB	Nat Immunol; Exosomes mediate the cell-to-cell transmission of IFN-α-induced antiviral activity.; Authors - Li Jianhua J
mouse	WB	Autophagy; TNFAIP8L2/TIPE2 impairs autolysosome reformation via modulating the RAC1-MTORC1 axis.; Authors - Wen Li ; KO Validated
mouse,human	WB	Sci Adv; TIPE2 is a checkpoint of natural killer cell maturation and antitumor immunity.; Authors - Jiacheng Bi ; KO Validated
human	WB	J Immunother Cancer; TIPE2 deletion improves the therapeutic potential of adoptively transferred NK cells; Authors - Jiacheng Bi ; KO Validated
mouse	WB	J Exp Med; TIPE2 specifies the functional polarization of myeloid-derived suppressor cells during tumorigenesis.; Authors - Dehong Yan ; KO Validated