• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated TNFAIP8L2 Polyclonal antibody

TNFAIP8L2 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-15940

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

TIPE2, Inflammation factor protein 20, Tumor necrosis factor alpha-induced protein 8-like protein 2, TNFAIP8-like protein 2, TNFAIP8 like protein 2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inRAW 264.7 cells
Positive FC (Intra) detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15940 targets TNFAIP8L2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7964

Product name: Recombinant human TNFAIP8L2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-184 aa of BC063014

Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL

Predict reactive species
Full Name tumor necrosis factor, alpha-induced protein 8-like 2
Calculated Molecular Weight 184 aa, 21 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberBC063014
Gene Symbol TIPE2
Gene ID (NCBI) 79626
RRIDAB_3083980
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6P589
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TIPE2 (TNF-α-inducible protein 8-like 2, or TNFAIP8L2), a negative immune regulator, is essential for maintaining immune homeostasis. TIPE2 shares considerable sequence homology with members of the tumor necrosis factor-α-inducible protein 8 (TNFAIP8) family, which are thought to regulate cellular and immune homeostasis. TIPE2 acts as a negative regulator of Toll-like receptor and T-cell receptor function and is preferentially expressed in lymphoid tissues. TIPE2 plays an essential role for a signal transduction pathway that links inflammatory immune response to specific conditions after cerebral ischemia

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TNFAIP8L2 antibody CL488-15940Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...