CoraLite®594-conjugated TNIK Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite®594-conjugated TNIK Recombinant monoclonal antibody (CL594-84231-4)

TNIK Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL594-84231-4

Clone No.241518D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

241518D9, EC:2.7.11.1, KIAA0551, TRAF2 and NCK-interacting protein kinase

• 

  IF Staining of K-562 using CL594-84231-4

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using CoraLite®594 TNIK antibody (CL594-84231-4, Clone: 241518D9 ) at dilution of 1:200.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF/ICC detected in: K-562 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-84231-4 targets TNIK in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34132

  Product name: Recombinant human TNIK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 585-636 aa of BC150256

  Sequence: LRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMP

• Full Name: TRAF2 and NCK interacting kinase
• Observed Molecular Weight: 155~180 kDa
• GenBank Accession Number: BC150256
• Gene Symbol: TNIK
• Gene ID (NCBI): 23043
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UKE5
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

TNIK (Traf2- and Nck-interacting kinase) is one of the germinal center kinase family members involved in cytoskeleton organization and neuronal dendrite extension, which had been implicated in postsynaptic signaling as well as in regulation of cell proliferation. TNiK is expressed in the nervous system and plays key roles at the synapse and nucleus, In non-neuronal cells, TNiK has been described as a critical component of transcriptional regulatory mechanisms, mediated by Wnt signaling (PMID: 24566388). TNIK is also an essential regulatory component of the T-cell factor-4 and β-catenin transcriptional complex and is required for the tumor-initiating function of colorectal cancer stem cells (PMID: 10521462). Western blot analysis detected TNIK at an apparent molecular mass of 150~180 kDa as cited in literature (PMID: 24566388).