• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated TNNC1 Polyclonal antibody

TNNC1 Polyclonal Antibody for IF/ICC
Cat No. CL488-13504

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

CMD1Z, TN C, TNC, TNNC, TNNC1, troponin C type 1 (slow)

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13504 targets TNNC1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4339

Product name: Recombinant human TNNC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-161 aa of BC030244

Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Predict reactive species
Full Name troponin C type 1 (slow)
Calculated Molecular Weight 161 aa, 18 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC030244
Gene Symbol TNNC1
Gene ID (NCBI) 7134
RRIDAB_3672568
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP63316
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. TnC plays an important role in excitation-contraction coupling and is the primary target of compounds such as levosimendan that augment Ca2+ responsiveness of the thin filament.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TNNC1 antibody CL488-13504Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...