CoraLite® Plus 488-conjugated TNNC1 Polyclonal antibody

• 

  IF Staining of U2OS using CL488-13504

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CoraLite® Plus 488 TNNC1 antibody (CL488-13504) at dilution of 1:200.

• Featured Product
• KD/KO Validated

TNNC1 Polyclonal Antibody for IF/ICC

Cat No. CL488-13504

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

CMD1Z, TN C, TNC, TNNC, TNNC1, troponin C type 1 (slow)

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13504 targets TNNC1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4339

  Product name: Recombinant human TNNC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-161 aa of BC030244

  Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

• Full Name: troponin C type 1 (slow)
• Calculated Molecular Weight: 161 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC030244
• Gene Symbol: TNNC1
• Gene ID (NCBI): 7134
• RRID: AB_3672568
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63316
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. TnC plays an important role in excitation-contraction coupling and is the primary target of compounds such as levosimendan that augment Ca2+ responsiveness of the thin filament.