TNP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TNP1 Polyclonal antibody, PBS Only (17178-1-PBS)

• 

  WB analysis of mouse testis using 17178-1-AP (same clone as 17178-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17178-1-AP (TNP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17178-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 17178-1-AP (same clone as 17178-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17178-1-AP (TNP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17178-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 17178-1-AP (same clone as 17178-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using 17178-1-AP (TNP1 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17178-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 17178-1-AP (same clone as 17178-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse testis tissue using 17178-1-AP (TNP1 antibody) at dilution of 1:200 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17178-1-PBS in a different storage buffer formulation.

TNP1 Polyclonal Antibody for WB, IF-P, IF-Fro, Indirect ELISA

Cat No. 17178-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, IF-Fro, Indirect ELISA

Synonyms

STP-1, TP-1

---

Product Information

17178-1-PBS targets TNP1 in WB, IF-P, IF-Fro, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10890

  Product name: Recombinant human TNP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-55 aa of BC029516

  Sequence: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL

• Full Name: transition protein 1 (during histone to protamine replacement)
• Calculated Molecular Weight: 55 aa, 7 kDa
• Observed Molecular Weight: 6-10 kDa
• GenBank Accession Number: BC029516
• Gene Symbol: TNP1
• Gene ID (NCBI): 7141
• RRID: AB_2206757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09430
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transition nuclear proteins (TNP1 and TNP2) are the major nuclear proteins that replace somatic histones during spermatogenesis. TNPs are required for normal chromatin condensation and functional sperm development, spermatogenesis was found to be compromised in both Tnp1 and Tnp2 null mice. TNP1, or TP1, localized in nucleus, is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines. Recently, TNP-1 was used as a germ cell marker in condensing spermatids.