CoraLite® Plus 488-conjugated TNP1 Polyclonal antibody

TNP1 Polyclonal Antibody for IF-P

Cat No. CL488-17178

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

STP 1, TNP1, TP 1, TP1

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse testis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17178 targets TNP1 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10890

Product name: Recombinant human TNP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-55 aa of BC029516

Sequence: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL

Predict reactive species
Full Name transition protein 1 (during histone to protamine replacement)
Calculated Molecular Weight 55 aa, 7 kDa
Observed Molecular Weight 6-10 kDa
GenBank Accession NumberBC029516
Gene Symbol TNP1
Gene ID (NCBI) 7141
RRIDAB_2919146
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09430
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Transition nuclear proteins (TNP1 and TNP2) are the major nuclear proteins that replace somatic histones during spermatogenesis. TNPs are required for normal chromatin condensation and functional sperm development, spermatogenesis was found to be compromised in both Tnp1 and Tnp2 null mice. TNP1, or TP1, localized in nucleus, is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines. Recently, TNP-1 was used as a germ cell marker in condensing spermatids.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TNP1 antibody CL488-17178Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...