Use Able AI chat for product recommendations

TOM20 Monoclonal antibody

TOM20 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66777-1-Ig
Clone No.1D6F5

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

TOMM20, 1D6F5, KIAA0016, MAS20, MOM19

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, THP-1 cells, K-562 cells
Positive IHC detected inhuman liver cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66777-1-Ig targets TOM20 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, monkey, chicken, bovine
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2378

Product name: Recombinant human TOM20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-145 aa of BC000882

Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Predict reactive species
Full Name translocase of outer mitochondrial membrane 20 homolog (yeast)
Calculated Molecular Weight 145 aa, 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC000882
Gene Symbol TOM20
Gene ID (NCBI) 9804
RRIDAB_2882123
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15388
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TOM20, also named as KIAA0016, belongs to the Tom20 family. It is a central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22, TOM20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. TOM20 is characterized as major docking receptors to mediate the recognition by different mechanisms.

Protocols

Product Specific Protocols
FC protocol for TOM20 antibody 66777-1-IgDownload protocol
IF protocol for TOM20 antibody 66777-1-IgDownload protocol
IHC protocol for TOM20 antibody 66777-1-IgDownload protocol
WB protocol for TOM20 antibody 66777-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Science

Structural insight into the SAM-mediated assembly of the mitochondrial TOM core complex.

Authors - Qiang Wang
humanIF

J Pineal Res

Melatonin and verteporfin synergistically suppress the growth and stemness of head and neck squamous cell carcinoma through the regulation of mitochondrial dynamics

Authors - Ye Young Shin
human

Brain

Inhibiting mitochondrial fission rescues degeneration in hereditary spastic paraplegia neurons.

Authors - Zhenyu Chen
WB

Redox Biol

Hypoxic acclimation improves cardiac redox homeostasis and protects heart against ischemia-reperfusion injury through upregulation of O-GlcNAcylation.

Authors - Wei Ou
humanIF

Br J Cancer

Loss of NDUFS1 promotes gastric cancer progression by activating the mitochondrial ROS-HIF1α-FBLN5 signaling pathway

Authors - Tao Chen

ACS Appl Mater Interfaces

An Olsalazine-Loaded Hollow Mesoporous Prussian Blue/Polydopamine Nanozyme Alleviates Anxiety/Depression-like Behavior and Enhances Brain Neural Activity in Colitis Mice

Authors - Qian Luo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Quanyuan (Verified Customer) (04-06-2026)

This antibody doesn't work in the WB assays (the second band from bottom to the top of the marker is 15kDa, in the attached result), comparing to the Rabbit anti-TOM20 from another company which works very good.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: keratinocyte and endothelia cells
TOM20 Antibody Western Blot validation (1000 dilution) in keratinocyte and endothelia cells (Cat no:66777-1-Ig)

Pierre (Verified Customer) (09-26-2025)

Very Good

  • Applications: Western Blot
  • Cell Tissue Type: T cells

Paula (Verified Customer) (08-06-2024)

Worked well for human bone marrow mesenchymal stem cells. Secondary antibody dilution used 1:400 for 90min room temp.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human
TOM20 Antibody Immunofluorescence validation (1:500 dilution) in Human (Cat no:66777-1-Ig)

Elena (Verified Customer) (05-06-2024)

Specific detection

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: iPSC-derived motor neurons

Boyan (Verified Customer) (02-22-2024)

good for imaging experiments

  • Applications: Immunofluorescence
Loading...
||
New chat

Able

正在加载,请稍候...