TP63 Recombinant monoclonal antibody, PBS Only

TP63 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA, ChIP-qPCR
Cat No. 86154-1-PBS
Clone No.250042G4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA, ChIP-qPCR

p63, CUSP, TP 63, Transformation-related protein 63, Tumor protein 63

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86154-1-PBS targets TP63 in WB, IHC, Indirect ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2791

Product name: Recombinant human TP63 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 381-680 aa of BC039815

Sequence: NTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE

Predict reactive species
Full Name tumor protein p63
Calculated Molecular Weight 680 aa, 77 kDa
Observed Molecular Weight63-68 kDa
GenBank Accession NumberBC039815
Gene Symbol TP63
Gene ID (NCBI) 8626
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H3D4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TP63, also named KET, P63, P73H, P73L and TP73L, belongs to the p53 family. It is a homologue of the tumor suppressor p53 and p73 genes. It is involved in malignancy acquisition and maintenance of cells. Unlike p53, the p63 gene encodes multiple isotypes with remarkably divergent abilities to transactivate p53 reporter genes and induce apoptosis. TP63 acts as a sequence specific DNA binding transcriptional activator or repressor. TP63 has 12 isoforms with MW 40kd(P40), 50kd(P60),63kd(P63) and 73kd(P73L).

Loading...
||
New chat Able
正在加载,请稍候...