TPD52L2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TPD52L2 Polyclonal antibody, PBS Only (11795-1-PBS)

• 

  WB analysis using 11795-1-AP (same clone as 11795-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11795-1-AP (TPD52L2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11795-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HCT 116 using 11795-1-AP (same clone as 11795-1-PBS)

  WB result of TPD52L2 antibody (11795-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-TPD52L2 transfected HCT 116 cells. This data was developed using the same antibody clone with 11795-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 11795-1-AP (same clone as 11795-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 11795-1-AP (TPD52L2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11795-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 11795-1-AP (same clone as 11795-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11795-1-AP (TPD52L2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11795-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 11795-1-AP (same clone as 11795-1-PBS)

  IP result of anti-TPD52L2 (IP:11795-1-AP, 3ug; Detection:11795-1-AP 1:800) with HEK-293 cells lysate 2400ug. This data was developed using the same antibody clone with 11795-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11795-1-AP (same clone as 11795-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11795-1-AP (TPD52L2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11795-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11795-1-AP (same clone as 11795-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11795-1-AP (TPD52L2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11795-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11795-1-AP (same clone as 11795-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 11795-1-AP (TPD52L2 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11795-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TPD52L2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 11795-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

TPD54, Tumor protein D52-like 2

---

Product Information

11795-1-PBS targets TPD52L2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2364

  Product name: Recombinant human TPD52L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC006804

  Sequence: MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLS

• Full Name: tumor protein D52-like 2
• Calculated Molecular Weight: 206 aa, 22 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC006804
• Gene Symbol: TPD52L2
• Gene ID (NCBI): 7165
• RRID: AB_2207431
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43399
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tumor protein D52-like proteins (TPD52) are small coiled-coil motif bearing proteins that were first identified in breast carcinoma. Three human TPD52 members had been identified, named hD52 (TPD52), hD53 (TPD52L1), and hD54 (TPD52L2). The most important characteristic of the protein family is a highly conserved coiled-coil motif that is required for homo- and heteromeric interaction with other TPD52-like proteins. TPD52 and related proteins have been implicated in cell proliferation, apoptosis, and vesicle trafficking. TPD52L2 has five isoforms produced by alternative splicing, and its multiple sites have been identified to be phosphorylated. Interaction of TPD52L2 with MAL2, a novel member of the MAL proteolipid family, may be required for the role of TPD52L2 in vesicle transport.