CoraLite® Plus 488-conjugated TPRKB Monoclonal antibody

TPRKB Monoclonal Antibody for IF/ICC
Cat No. CL488-66402
Clone No.2D5B9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

CGI 121, My019, PRPK binding protein, TP53RK binding protein, TPRKB

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66402 targets TPRKB in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18770

Product name: Recombinant human TPRKB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-175 aa of BC029492

Sequence: MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL

Predict reactive species
Full Name TP53RK binding protein
Calculated Molecular Weight 175 aa, 20 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberBC029492
Gene Symbol TPRKB
Gene ID (NCBI) 51002
RRIDAB_2934460
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y3C4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TPRKB, also named as CGI 121, belongs to the CGI121/TPRKB family. It interacts with TP53RK/PRPK and is widely expressed in all tissues.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TPRKB antibody CL488-66402Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...