TRAF2 Polyclonal antibody

• 

  WB analysis using 26846-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26846-1-AP (TRAF2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 26846-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 26846-1-AP (TRAF2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 26846-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26846-1-AP (TRAF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 26846-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26846-1-AP (TRAF2 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 26846-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26846-1-AP (TRAF2 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HeLa using 26846-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 26846-1-AP (TRAF2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HUVEC using 26846-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HUVEC cells using 26846-1-AP (TRAF2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

TRAF2 Polyclonal Antibody for WB, ELISA

Cat No. 26846-1-AP

Publications(37)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (4)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

TRAP3, TRAP, TNF receptor-associated factor 2, RING-type E3 ubiquitin transferase TRAF2, EC:2.3.2.27

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, human testis tissue, Jurkat cells, MOLT-4 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 31 publications below
• IHC: See 4 publications below
• IF: See 5 publications below
• IP: See 1 publications below

Product Information

26846-1-AP targets TRAF2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, bovine, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25387

  Product name: Recombinant human TRAF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 438-501 aa of BC032410

  Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL

• Full Name: TNF receptor-associated factor 2
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC032410
• Gene Symbol: TRAF2
• Gene ID (NCBI): 7186
• RRID: AB_2880656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12933
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tumor necrosis factor (TNF) receptor-associated factor-2 (TRAF2) is one of the members of the TRAF superfamily protein, which is an intracellular junction protein with E3 ligase activity. TRAF2 mediates and regulates the activation of nuclear factor kappa B (NF-κB) and microtubule-associated protein kinase (MAPK) signaling pathways by binding to TNFR family proteins. Recent studies have demonstrated that TRAF2 regulates tumor progression by through multiple pathways.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Emerg Microbes Infect; African swine fever virus modulates the endoplasmic reticulum stress-ATF6-calcium axis to facilitate viral replication; Authors - Yanjin Wang
mouse	WB	Redox Biol; FUT2-dependent fucosylation of HYOU1 protects intestinal stem cells against inflammatory injury by regulating unfolded protein response; Authors - Zhe Wang
human	IHC	J Hematol Oncol; Integrated proteogenomic characterization of urothelial carcinoma of the bladder.; Authors - Ning Xu
mouse	WB	J Hazard Mater; Endoplasmic reticulum stress manipulates autophagic response that antagonizes polybrominated diphenyl ethers quinone induced cytotoxicity in microglial BV2 cells.; Authors - Qiushuang Zhu
human	WB	EMBO Rep; Snail enhances arginine synthesis by inhibiting ubiquitination-mediated degradation of ASS1.; Authors - Hao Jia ; KD Validated
human,mouse	WB,IHC,IF	Free Radic Biol Med; TRAF2 inhibits senescence in hepatocellular carcinoma cells via regulating the ROMO1/ NAD+/SIRT3/SOD2 axis; Authors - Jiping Yao ; KD Validated