DcR2 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 85425-2-RR (same clone as 85425-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85425-2-RR (DcR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85425-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 85425-2-RR (same clone as 85425-2-PBS)

  Human kidney lysate was subjected to SDS PAGE followed by western blot with 85425-2-RR (DcR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85425-2-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP01996-1

  Sandwich ELISA standard curve of MP01996-1, Human DcR2 Recombinant Matched Antibody Pair - PBS only. 85425-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg3487. 85425-2-PBS was HRP conjugated as the detection antibody. Range: 0.391-25 ng/mL

• 

  Sample test of MP01996-1

  The mean DcR2 concentration was determined to be 8.72 ng/mL in HCT116 cell extract based on a 1.4 mg/mL extract load.

• 

  IHC staining of mouse liver using 85425-2-RR (same clone as 85425-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85425-2-RR (DcR2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85425-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 85425-2-RR (same clone as 85425-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85425-2-RR (DcR2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85425-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP01996-1

  Cytometric bead array standard curve of MP01996-1, DcR2 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85425-1-PBS. Detection antibody: 85425-2-PBS. Standard: Eg3487. Range: 0.781-100 ng/mL.

DcR2 Uni-rAb^® Recombinant Antibody for WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85425-2-PBS

Clone No.242916C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD264, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TNFRSF10D, TRAIL R4

---

Product Information

85425-2-PBS targets DcR2 as part of a matched antibody pair:

MP01996-1: 85425-1-PBS capture and 85425-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3487

  Product name: Recombinant Human DcR2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 56-211 aa of NM_003840.5

  Sequence: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH

• Full Name: tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: NM_003840.5
• Gene Symbol: DcR2
• Gene ID (NCBI): 8793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UBN6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Decoy receptor 2 (DcR2) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It functions as a decoy receptor for TNF-related apoptosis-inducing ligand (TRAIL), thereby inhibiting TRAIL-mediated apoptosis (PMID: 15538968; 9537512). It has been considered a tentative marker of cellular senescence (PMID: 16079833; 22751116). Additionally, DCR2 has been implicated in the regulation of renal fibrosis and cell senescence, contributing to the pathogenesis of diabetic nephropathy (PMID: 35661704).