DcR2 Recombinant monoclonal antibody

• 

  WB analysis using 85425-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85425-2-RR (DcR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 85425-2-RR

  Human kidney lysate was subjected to SDS PAGE followed by western blot with 85425-2-RR (DcR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 85425-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85425-2-RR (DcR2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 85425-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85425-2-RR (DcR2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DcR2 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85425-2-RR

Clone No.242916C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CD264, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TNFRSF10D, TRAIL R4

---

Tested Applications

• Positive WB detected in: human kidney tissue, mouse liver tissue, rat liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85425-2-RR targets DcR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3487

  Product name: Recombinant Human DcR2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 56-211 aa of NM_003840.5

  Sequence: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH

• Full Name: tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: NM_003840.5
• Gene Symbol: DcR2
• Gene ID (NCBI): 8793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UBN6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Decoy receptor 2 (DcR2) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It functions as a decoy receptor for TNF-related apoptosis-inducing ligand (TRAIL), thereby inhibiting TRAIL-mediated apoptosis (PMID: 15538968; 9537512). It has been considered a tentative marker of cellular senescence (PMID: 16079833; 22751116). Additionally, DCR2 has been implicated in the regulation of renal fibrosis and cell senescence, contributing to the pathogenesis of diabetic nephropathy (PMID: 35661704).