Tested Applications
| Positive WB detected in | HL-60 cells, HeLa cells, mouse heart tissue, Raji cells, HepG2 cells, K-562 cells, NIH/3T3 cells |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10325-1-AP targets TRAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0400 Product name: Recombinant human TRAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 446-704 aa of BC000406 Sequence: MREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH Predict reactive species |
| Full Name | TNF receptor-associated protein 1 |
| Calculated Molecular Weight | 80 kDa |
| Observed Molecular Weight | 66-70 kDa, 60 kDa |
| GenBank Accession Number | BC000406 |
| Gene Symbol | TRAP1 |
| Gene ID (NCBI) | 10131 |
| RRID | AB_2303284 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12931 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TNF receptor-associated protein 1 (TRAP1, synonym: HSP75) is a member of the HSP90 family of molecular chaperones, and is expressed ubiquitously and located to mitochondria. A unique LxCxE motif in HSP75, but not in other HSP90 family members, appears to be important for binding to the simian virus 40 T-antigen-binding domain of hypophosphorylated Rb. Data also suggests that suppression of the expression of TRAP1 in mitochondria plays an important role in the induction of apoptosis caused via formation of reactive oxygen species (ROS).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRAP1 antibody 10325-1-AP | Download protocol |
| IHC protocol for TRAP1 antibody 10325-1-AP | Download protocol |
| WB protocol for TRAP1 antibody 10325-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
10325-1-AP is an anti-TRAP1 antibody with 20 citations. It appears in journals including Nature Nanotechnology, Nature Immunology, Molecular Cell, Journal of Cell Biology, Journal of Controlled Release, Apoptosis, Cancer Cell International, Cell Signaling, Glia, International Journal of Molecular Sciences, and Scientific Reports. Research fields span mitochondrial biology, cancer immunology, apoptosis and ferroptosis, osteoclast differentiation, diabetic complications, neuroinflammation, and skeletal muscle biology, with applications in WB, IF, and IHC.
| Species | Application | Title |
|---|---|---|
Nat Nanotechnol An orally administered gene editing nanoparticle boosts chemo-immunotherapy in colorectal cancer | ||
Nat Immunol Cancer suppresses mitochondrial chaperone activity in macrophages to drive immune evasion | ||
Mol Cell Deciphering functional tumor-immune crosstalk through highly multiplexed imaging and deep visual proteomics | ||
J Control Release Acid neutralization and metal-phenolic nanomedicine on-demand release microspheres for reversing cartilage degeneration. | ||
Apoptosis Ochratoxin A-induced mitochondrial pathway apoptosis and ferroptosis by promoting glycolysis | ||
Cancer Cell Int Stress granules affect the dual PI3K/mTOR inhibitor response by regulating the mitochondrial unfolded protein response |
Reviews
What customers say
Both reviewers rated the antibody 5/5 for Western blot at a 1:1000 dilution. One user described it as a solid choice for detecting the mitochondrial chaperone TRAP1, noting consistent signal and good specificity. The other reported some background but confirmed reliable results when validated with positive and negative controls. Overall, users find the antibody specific and dependable for WB applications, with minor background manageable through proper controls.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jelan (Verified Customer) (01-14-2026) | The TRAP1 antibody from Proteintech is a solid choice for detecting a mitochondrial chaperone, with generally consistent signal and good specificity in Western blot applications.
|
Haley (Verified Customer) (12-01-2025) | Some background but was able to validate results with positive and negative controls
|
