• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated TRAP1 Polyclonal antibody

TRAP1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10325

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

TNFR associated protein 1, HSPC5, HSP90L, HSP75, HSP 75

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10325 targets TRAP1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0400

Product name: Recombinant human TRAP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 446-704 aa of BC000406

Sequence: MREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH

Predict reactive species
Full Name TNF receptor-associated protein 1
Calculated Molecular Weight 80 kDa
Observed Molecular Weight 66-70 kDa, 60 kDa
GenBank Accession NumberBC000406
Gene Symbol TRAP1
Gene ID (NCBI) 10131
RRIDAB_2918971
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ12931
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TNF receptor-associated protein 1 (TRAP1, synonym: HSP75) is a member of the HSP90 family of molecular chaperones, and is expressed ubiquitously and located to mitochondria. A unique LxCxE motif in HSP75, but not in other HSP90 family members, appears to be important for binding to the simian virus 40 T-antigen-binding domain of hypophosphorylated Rb. Data also suggests that suppression of the expression of TRAP1 in mitochondria plays an important role in the induction of apoptosis caused via formation of reactive oxygen species (ROS).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TRAP1 antibody CL488-10325Download protocol
FC protocol for CL Plus 488 TRAP1 antibody CL488-10325Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...