Tested Applications
| Positive WB detected in | HeLa cells, HL-60 cells, HSC-T6 cells, Jurkat cells, NIH/3T3 cells, NCI-H1299 cells, HepG2 cells, PC-12 cells |
| Positive IHC detected in | human breast cancer tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67136-1-Ig targets TRIM21 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28377 Product name: Recombinant human TRIM21 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 176-475 aa of BC010861 Sequence: SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY Predict reactive species |
| Full Name | tripartite motif-containing 21 |
| Calculated Molecular Weight | 475 aa, 54 kDa |
| Observed Molecular Weight | 42-54 kDa |
| GenBank Accession Number | BC010861 |
| Gene Symbol | TRIM21 |
| Gene ID (NCBI) | 6737 |
| RRID | AB_2882435 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P19474 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM21 has multiple N-terminal zinc finger motifs(has E3 ligase activity), a central leucine zipper, and a potential N-glycosylation site. TRIM21 is a E3 ubiquitin-protein ligase. It can form a ubiquitin ligase complex with E2 UBE2D2, which function not only for the uniquitination of USP4 and IKBKB but also for its self-ubiquitination. It has a role in the regulation of the cell cycle progression and could enhance the decapping activity of DCP2. It can exist in all mammalian cells as a ribonucleoprotein particle , which composed of a single polypeptide and 1 of 4 small RNA molecules. TRIM21 exists various isoforms and range molecular weight of isoforms is about 42-45kDa and 49-54 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRIM21 antibody 67136-1-Ig | Download protocol |
| IHC protocol for TRIM21 antibody 67136-1-Ig | Download protocol |
| WB protocol for TRIM21 antibody 67136-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TRIM21 Monoclonal Antibody (catalog number 67136-1-Ig) has 36 citations. These appear in journals including Gastroenterology, Autophagy, Theranostics, Cell Death & Disease, EMBO Journal, Developmental Cell, Nature Communications, Journal of Clinical Investigation Insight, Molecular Therapy, and International Immunopharmacology. Research fields span cancer biology (pancreatic, breast, liver, and lung cancers), ubiquitination and protein degradation, innate immunity and viral infections (SARS-CoV-2, tuberculosis, rabies), metabolic disorders (diabetes, lipid metabolism), stress granules, ferroptosis, and autoimmune diseases such as lupus and Sjögren's syndrome.
| Species | Application | Title |
|---|---|---|
Gastroenterology Stromal Stiffness-Regulated IGF2BP2 in Pancreatic Cancer Drives Immune Evasion via Sphingomyelin Metabolism | ||
Autophagy Stress granule homeostasis is modulated by TRIM21-mediated ubiquitination of G3BP1 and autophagy-dependent elimination of stress granules
| ||
Theranostics E3 ubiquitin ligase TRIM21 targets TIF1γ to regulate β-catenin signaling in glioblastoma | ||
Research (Wash D C) Inhibiting TRIM21 Neddylation Rejuvenates Oocyte Quality in PCOS by Regulating Ubiquitination of CPT1A.
| ||
Cell Death Dis Prolyl 4-hydroxylase subunit alpha-2 acts as a TRIM21 ubiquitination substrate to promote papillary thyroid cancer progression via the glycolytic pathway | ||
Cell Death Dis Cathepsin D promotes acute myeloid leukemia progression through stabilization of the anti-apoptotic proteins |
