Home
Products
Primary Antibodies
TRIM36 Polyclonal antibody, PBS Only (25913-1-PBS)

Filter: AllIHCIF-P

IHC staining of mouse testis using 25913-1-AP (same clone as 25913-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25913-1-AP (TRIM36 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25913-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 25913-1-AP (same clone as 25913-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25913-1-AP (TRIM36 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25913-1-PBS in a different storage buffer formulation.
IHC staining of rat testis using 25913-1-AP (same clone as 25913-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 25913-1-AP (TRIM36 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25913-1-PBS in a different storage buffer formulation.
IHC staining of rat testis using 25913-1-AP (same clone as 25913-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 25913-1-AP (TRIM36 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25913-1-PBS in a different storage buffer formulation.
IF Staining of mouse testis using 25913-1-AP (same clone as 25913-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using TRIM36 antibody (25913-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25913-1-PBS in a different storage buffer formulation.
IF Staining of mouse testis using 25913-1-AP (same clone as 25913-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using TRIM36 antibody (25913-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25913-1-PBS in a different storage buffer formulation.

TRIM36 Polyclonal antibody, PBS Only

TRIM36 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 25913-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase TRIM36, EC:2.3.2.27, RING-type E3 ubiquitin transferase TRIM36, RNF98, tripartite motif containing 36

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

25913-1-PBS targets TRIM36 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag23240 Product name: Recombinant human TRIM36 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 166-215 aa of BC130334 Sequence: ESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEH Predict reactive species
Full Name	tripartite motif-containing 36
Observed Molecular Weight	83 kDa
GenBank Accession Number	BC130334
Gene Symbol	TRIM36
Gene ID (NCBI)	55521
RRID	AB_2880293
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NQ86
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

TRIM36, a member of the tripartite motif (TRIM) family of RING-containing proteins, also known as Haprin, is a microtubule-associated E3 ubiquitin ligase that plays a role in cytoskeletal organization, which was first discovered for its abundance in testis and found to be implicated in the spermatozoa acrosome reaction (PMID: 35053362, 30944633). TRIM36 was reported as a novel androgen signaling target gene and is upregulated in prostate cancer (PMID: 29449534).