TRPV6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRPV6 Polyclonal antibody, PBS Only (13411-1-PBS)

• 

  WB analysis of human placenta using 13411-1-AP (same clone as 13411-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13411-1-AP (TRPV6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13411-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 13411-1-AP (same clone as 13411-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13411-1-AP (TRPV6 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13411-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 13411-1-AP (same clone as 13411-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13411-1-AP (TRPV6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13411-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 13411-1-AP (same clone as 13411-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13411-1-AP (TRPV6 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13411-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse kidney using 13411-1-AP (same clone as 13411-1-PBS)

  IP result of anti-TRPV6 (IP:13411-1-AP, 4ug; Detection:13411-1-AP 1:300) with mouse kidney tissue lysate 4000ug. This data was developed using the same antibody clone with 13411-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13411-1-AP (same clone as 13411-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TRPV6 antibody (13411-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 13411-1-PBS in a different storage buffer formulation.

TRPV6 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 13411-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

CATL, CaT1, CaT like, CaT L, Calcium transport protein 1

---

Product Information

13411-1-PBS targets TRPV6 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4060

  Product name: Recombinant human TRPV6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC034814

  Sequence: MYVENHCSRPALLLQLWGRGSPAQARGWQGVRNSPVACSSPFRQEHCMSEHFKNRPACLGARSPPQGHKWGESPSQGTQAGAGKCRACGKRVSEGDRNGSGGGKWG

• Full Name: transient receptor potential cation channel, subfamily V, member 6
• Calculated Molecular Weight: 725 aa, 83 kDa
• Observed Molecular Weight: 83 kDa, 70 kDa
• GenBank Accession Number: BC034814
• Gene Symbol: TRPV6
• Gene ID (NCBI): 55503
• RRID: AB_2272390
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1D0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRPV6, also named as CAT1 or ECaC2, is a member of the transient receptor potential (TRP) family of membrane proteins. Unlike most TRP channels, TRPV6 and its closest relative, TRPV5, are calcium-selective channels. TRPV6 is highly expressed in the proximal intestine, placenta and exocrine tissues (PMID: 12869611). It is probably involved in calcium absorption in various tissues, including calcium reabsorption in kidney. TRPV6 is overexpressed in some cancers and exhibits oncogenic potential.