TSEN34 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TSEN34 Polyclonal antibody, PBS Only (31212-1-PBS)

• 

  WB analysis using 31212-1-AP (same clone as 31212-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31212-1-AP (TSEN34 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31212-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31212-1-AP (same clone as 31212-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31212-1-AP (TSEN34 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31212-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 31212-1-AP (same clone as 31212-1-PBS)

  WB result of TSEN34 antibody (31212-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TSEN34 transfected MCF-7 cells. This data was developed using the same antibody clone with 31212-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 31212-1-AP (same clone as 31212-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using TSEN34 antibody (31212-1-AP) at dilution of 1:600 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31212-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TSEN34 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31212-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:4.6.1.16, HsSen34, LENG5, PCH2C, SEN34

---

Product Information

31212-1-PBS targets TSEN34 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35120

  Product name: Recombinant human TSEN34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-165 aa of BC020805

  Sequence: LMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPS

• Full Name: tRNA splicing endonuclease 34 homolog (S. cerevisiae)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34-36 kDa
• GenBank Accession Number: BC020805
• Gene Symbol: TSEN34
• Gene ID (NCBI): 79042
• RRID: AB_3669904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BSV6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The human tRNA splicing endonuclease consists of a heterotetramer complex formed by the four TSEN proteins, which were identified by homology with their yeast counterparts. TSEN2 and TSEN34 are the catalytic subunits, which form a compound active site, whereas TSEN54 and TSEN15 are structural proteins. (PMID: 27392077)