CoraLite® Plus 488-conjugated TTC30A Polyclonal antibody

• 

  IF Staining of hTERT-RPE1 using CL488-25352

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using CoraLite® Plus 488 TTC30A antibody (CL488-25352) at dilution of 1:200, CoraLite®594 ARL13B antibody (CL594-17711, red).

• Featured Product
• KD/KO Validated

TTC30A Polyclonal Antibody for IF/ICC

Cat No. CL488-25352

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

IFT70, TPR repeat protein 30A, TTC30A

---

Tested Applications

• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-25352 targets TTC30A in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18361

  Product name: Recombinant human TTC30A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-342 aa of BC042848

  Sequence: MAGLSGAQIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGDNETDGQVNLGCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADV

• Full Name: tetratricopeptide repeat domain 30A
• Calculated Molecular Weight: 665 aa, 76 kDa
• Observed Molecular Weight: 72-76 kDa
• GenBank Accession Number: BC042848
• Gene Symbol: TTC30A
• Gene ID (NCBI): 92104
• RRID: AB_3672792
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86WT1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Tetratricopeptide repeat protein 30A (TTC30A) as a component of ciliary segmentation, may be essential for cartilage differentiation and renal tubulogenesis (PMID: 34548398). It is required for polyglutamylation of axonemal tubulin and plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip.