TTC30A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TTC30A Polyclonal antibody (25352-1-AP)

• Featured Product
• KD/KO Validated

TTC30A Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 25352-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Synonyms

IFT70A, TPR repeat protein 30A, Intraflagellar transport protein 70A

• 

  WB analysis using 25352-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25352-1-AP (TTC30A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 25352-1-AP

  WB result of TTC30A antibody (25352-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TTC30A transfected A431 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 25352-1-AP

  IP result of anti-TTC30A (IP:25352-1-AP, 4ug; Detection:25352-1-AP 1:500) with HEK-293 cells lysate 2600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of hTERT-RPE1 using 25352-1-AP

  Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using TTC30A antibody (25352-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), acetylated Tubulin(Lys40) antibody (66200-1-Ig, Clone: 7E5H8, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TTC30A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HEK-293 cells, mouse testis, rat testis
• Positive IP detected in: HEK-293 cells
• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25352-1-AP targets TTC30A in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18361

  Product name: Recombinant human TTC30A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-342 aa of BC042848

  Sequence: MAGLSGAQIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGDNETDGQVNLGCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADV

• Full Name: tetratricopeptide repeat domain 30A
• Calculated Molecular Weight: 665 aa, 76 kDa
• Observed Molecular Weight: 72-76 kDa
• GenBank Accession Number: BC042848
• Gene Symbol: TTC30A
• Gene ID (NCBI): 92104
• RRID: AB_2651172
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86WT1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TTC30A Polyclonal antibody (Cat# 25352-1-AP) has 4 total citations. These appear in Developmental Cell, European Journal of Human Genetics, Cell Structure and Function, and Biology Open. The associated research fields include intraflagellar transport (IFT) complex assembly, ciliogenesis, centriole biology, and a ciliary disorder (cranioectodermal dysplasia caused by a CILK1 variant).

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Dev Cell; The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base.; Authors - Tomoharu Kanie
		Eur J Hum Genet; A homozygous frameshift variant in the CILK1 gene causes cranioectodermal dysplasia; Authors - Abdullah Sezer
human	WB	Cell Struct Funct; Assembly and mother centriole recruitment of IFT-B subcomplexes to form IFT-B holocomplex; Authors - Koshi Tasaki
human	WB,IF	Biol Open; Robust interaction of IFT70 with IFT52-IFT88 in the IFT-B complex is required for ciliogenesis.; Authors - Ryota Takei