TYROBP/DAP12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TYROBP/DAP12 Polyclonal antibody, PBS Only (28138-1-PBS)

• 

  WB analysis using 28138-1-AP (same clone as 28138-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 28138-1-AP (TYROBP / DAP12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28138-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 28138-1-AP (same clone as 28138-1-PBS)

  WB result of TYROBP/DAP12 antibody (28138-1-AP; 1:600; room temperature for 1.5 hours) with wild-type and sg-TYROBP/DAP12 transfected RAW 264.7 cells. This data was developed using the same antibody clone with 28138-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TYROBP/DAP12 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28138-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

TYROBP, DAP12, DNAX activation protein 12, DNAX-activation protein 12, KAR associated protein

---

Product Information

28138-1-PBS targets TYROBP/DAP12 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27252

  Product name: Recombinant human TYROBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of BC011175

  Sequence: MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK

• Full Name: TYRO protein tyrosine kinase binding protein
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 10-12 kDa
• GenBank Accession Number: BC011175
• Gene Symbol: TYROBP
• Gene ID (NCBI): 7305
• RRID: AB_3669646
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43914
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TYROBP, also known as DAP12 or KARAP, is a transmembrane protein consisting of a very small extracellular region, a transmembrane domain containing an aspartic acid residue critical for association with its partner subunits, and an intracellular domain with a single immunoreceptor tyrosine-based activation motif (ITAM) (PMID: 11114420). It is expressed as a disulfide-bonded homodimer on natural killer cells, myeloid cells and a subset of T cells (PMID: 11114420). TYROBP acts as a signaling adaptor that provides signaling function via the Syk and ZAP-70 tyrosine kinase activation pathways (PMID: 15895090). The gene of TYROBP is located on the long arm of chromosome 19 at position 13.1. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene.