Testin Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Testin Recombinant monoclonal antibody, PBS Only (86013-3-PBS)

• 

  WB analysis using 86013-3-RR (same clone as 86013-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86013-3-RR (Testin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86013-3-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 86013-3-RR (same clone as 86013-3-PBS)

  IP result of anti-Testin (IP:86013-3-RR, 4ug; Detection:86013-3-RR 1:1000) with K-562 cells lysate 2440 ug. This data was developed using the same antibody clone with 86013-3-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 86013-3-RR (same clone as 86013-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using Testin antibody (86013-3-RR, Clone: 250432C8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86013-3-PBS in a different storage buffer formulation.

• 

  Affinity of 86013-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86013-3-RR against Human Testin were performed. The affinity constant is 2.17 nM.

Testin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 86013-3-PBS

Clone No.250432C8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

TES

---

Product Information

86013-3-PBS targets Testin in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0379

  Product name: Recombinant human TES protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 108-323 aa of BC001451

  Sequence: TVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHL

• Full Name: testis derived transcript (3 LIM domains)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 42-48 kDa
• GenBank Accession Number: BC001451
• Gene Symbol: TES
• Gene ID (NCBI): 26136
• RRID: AB_3744550
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UGI8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Testin (TES) is a cytoskeleton-associated protein that localizes along actin stress fibers at cell-cell contact areas and at focal adhesion plaques. It interacts with a variety of cytoskeletal proteins and gets involved in regulation of cell adhesion and migration. TES is a putative tumor suppressor and reduced expression of TES has been reported in various cancers. In addition, TES is a marker for Sertoli-Germ Cell junction and is useful to monitor the disruption of intercellular junctions in the testis.