Tie-2/CD202b Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Tie-2/CD202b Polyclonal antibody, PBS Only (19157-1-PBS)

• 

  WB analysis of mouse lung using 19157-1-AP (same clone as 19157-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 19157-1-AP (Tie-2/CD202b antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19157-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 19157-1-AP (same clone as 19157-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 19157-1-AP (Tie2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19157-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse lung using 19157-1-AP (same clone as 19157-1-PBS)

  IP result of anti-Tie-2/CD202b (IP:19157-1-AP, 4ug; Detection:19157-1-AP 1:1000) with mouse lung tissue lysate 1240 ug. This data was developed using the same antibody clone with 19157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 19157-1-AP (same clone as 19157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 19157-1-AP (Tie2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 19157-1-AP (same clone as 19157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 19157-1-AP (Tie2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 19157-1-AP (same clone as 19157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 19157-1-AP (Tie2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19157-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HUVEC using 19157-1-AP (same clone as 19157-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HUVEC cells using Tie-2/CD202b antibody (19157-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 19157-1-PBS in a different storage buffer formulation.

Tie-2/CD202b Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 19157-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

TEK, Angiopoietin 1 receptor, Angiopoietin-1 receptor, CD202B, EC:2.7.10.1

---

Product Information

19157-1-PBS targets Tie-2/CD202b in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13523

  Product name: Recombinant human TEK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 779-1124 aa of BC035514

  Sequence: RRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSHHLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA

• Full Name: TEK tyrosine kinase, endothelial
• Calculated Molecular Weight: 1124 aa, 126 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC035514
• Gene Symbol: Tie2
• Gene ID (NCBI): 7010
• RRID: AB_10644297
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02763
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tie2 (also known as TEK) is a tyrosine-protein kinase expressed almost exclusively on endothelial cells. It contains two immunoglobulin-like domains, three epidermal growth factor (EGF)--like domains and three fibronectin type III repeats. Tie2 acts as a cell-surface receptor for ANGPT1, ANGPT2, and ANGPT4 and regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Mutations in the gene Tie2 are associated with inherited venous malformations of the skin and mucous membranes. Human Tie2 has a calculated molecular weight of 126 kDa. As a result of glycosylation, the apparent molecular mass of Tie2 is approximately 140-160 kDa.