TIM23 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• TIM23 Monoclonal antibody (67535-1-Ig)

TIM23 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67535-1-Ig Copied!

Clone No. 3H10F5

Publications (16)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

67535, TIMM23, 3H10F5, Mitochondrial import inner membrane translocase subunit Tim23, TIMM 23

• 

  WB analysis using 67535-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67535-1-Ig (Tim23 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 67535-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67535-1-Ig (Tim23 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 67535-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67535-1-Ig (Tim23 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67535-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TIM23 antibody (67535-1-Ig, Clone: 3H10F5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TIM23 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, RAW 264.7 cells, HeLa cells, MCF-7 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67535-1-Ig targets TIM23 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27069

  Product name: Recombinant human Tim23 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-208 aa of BC062707

  Sequence: MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFIPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL

• Full Name: translocase of inner mitochondrial membrane 23
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC062707
• Gene Symbol: TIMM23
• Gene ID (NCBI): 100287932
• RRID: AB_2882754
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O14925
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tim23 is a mitochondrial inner membrane protein essential for import of preproteins into the matrix. Tim23 together with Tim17 and Tim44 form the Tim23 complex which mediates the import of nuclear encoded preproteins into the mitochondria. Tim23 is commonly used as loading control for mitochondrial inner membrane protein.

Publications

What published studies show

The TIM23 Monoclonal antibody (3H10F5), catalog number 67535-1-Ig, has 16 citations. These appear in journals including Autophagy, Nature Communications, Advanced Science, Developmental Cell, Molecular Medicine, Communications Biology, Journal of Biological Chemistry, Scientific Reports, and others. Research fields span mitophagy, mitochondrial protein import, ferroptosis, hepatocellular carcinoma, muscle adaptation to exercise, vascular injury, acute kidney injury, liver ischemia-reperfusion injury, and pulmonary edema.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Autophagy; KDM4A-induced tumor senescence enhances the efficacy of immunotherapy by inhibiting AGT-PHB1 axis-mediated mitophagy in colorectal cancer; Authors - Tanxing Cai
human	WB	Autophagy; The nucleoprotein of influenza A virus inhibits the innate immune response by inducing mitophagy; Authors - Bo Zhang
mouse	WB,IF	Autophagy; Mycobacterium bovis induces mitophagy to suppress host xenophagy for its intracellular survival.; Authors - Yinjuan Song
mouse	WB	Autophagy; Mitophagy-mediated S1P facilitates muscle adaptive responses to endurance exercise through SPHK1-S1PR1/S1PR2 in slow-twitch myofibers; Authors - Minghong Leng
human	WB	Nat Commun; The integrated stress response suppresses PINK1-dependent mitophagy by preserving mitochondrial import efficiency.; Authors - Mingchong Yang
human	WB	Adv Sci (Weinh); Syntaxin 17 Translocation Mediated Mitophagy Switching Drives Hyperglycemia-Induced Vascular Injury; Authors - Anqi Luo