Titin Polyclonal antibody, PBS Only

• 

  IHC staining of mouse heart using 27867-1-AP (same clone as 27867-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 27867-1-AP (Titin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27867-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 27867-1-AP (same clone as 27867-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 27867-1-AP (Titin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27867-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 27867-1-AP (same clone as 27867-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 27867-1-AP (Titin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27867-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 27867-1-AP (same clone as 27867-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 27867-1-AP (Titin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27867-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skeletal muscle using 27867-1-AP (same clone as 27867-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using Titin antibody (27867-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27867-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skeletal muscle using 27867-1-AP (same clone as 27867-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using Titin antibody (27867-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27867-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 27867-1-AP (same clone as 27867-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using Titin antibody (27867-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27867-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 27867-1-AP (same clone as 27867-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using Titin antibody (27867-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27867-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 27867-1-AP (same clone as 27867-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using Titin antibody (27867-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27867-1-PBS in a different storage buffer formulation.

Titin Polyclonal Antibody for IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 27867-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

TTN

---

Product Information

27867-1-PBS targets Titin in IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27496

  Product name: Recombinant human TTN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33738-33969 aa of NM_001256850

  Sequence: MFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIK

• Full Name: titin
• Calculated Molecular Weight: 3816 kDa
• GenBank Accession Number: NM_001256850
• Gene Symbol: Titin
• Gene ID (NCBI): 7273
• RRID: AB_2880998
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WZ42
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Titin, or connectin, is a giant muscle protein expressed in the cardiac and skeletal muscles that spans half of the sarcomere from Z line to M line. It plays a key role in muscle contraction and relaxation, maintaining the structural integrity of the myotome(PMID: 11846417). Mutations in Titin are associated with familial hypertrophic cardiomyopathy 9, and autoantibodies to titin are produced in patients with the autoimmune disease scleroderma(PMID: 15802564).