• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Transgelin 2 Monoclonal antibody

Transgelin 2 Monoclonal Antibody for IF/ICC, IF-P
Cat No. CL488-60044
Clone No.2E5G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, IF-P

TAGLN2, Transgelin 2/TAGLN2, SM22-alpha homolog, Epididymis tissue protein Li 7e, CDABP0035

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman colon cancer tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60044 targets Transgelin 2 in IF/ICC, IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0337

Product name: Recombinant human TAGLN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 4-130 aa of BC002616

Sequence: RGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINAQYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLM

Predict reactive species
Full Name transgelin 2
Calculated Molecular Weight 199 aa, 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC002616
Gene Symbol Transgelin-2/TAGLN2
Gene ID (NCBI) 8407
RRIDAB_3084132
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP37802
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The transgelin family is a group of proteins that belong to 22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. Our test result showed that this antibody Is specific to TAGLN2. It does not bind TAGLN1 and TAGLN3.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Transgelin 2 antibody CL488-60044Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...