UBTD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UBTD1 Polyclonal antibody, PBS Only (20158-1-PBS)

• 

  WB analysis using 20158-1-AP (same clone as 20158-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20158-1-AP (UBTD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20158-1-PBS in a different storage buffer formulation.

UBTD1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20158-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

ubiquitin domain containing 1

---

Product Information

20158-1-PBS targets UBTD1 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14082

  Product name: Recombinant human UBTD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 118-227 aa of BC007331

  Sequence: YCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD

• Full Name: ubiquitin domain containing 1
• Calculated Molecular Weight: 227 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC007331
• Gene Symbol: UBTD1
• Gene ID (NCBI): 80019
• RRID: AB_3741979
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAC8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ubiquitin domain-containing protein 1 (UBTD1) is highly evolutionary conserved and has been described to interact with E2 enzymes of the ubiquitin-proteasome system. Even if its biological functions remain largely unknown, UBTD1 expression is regulated by P53 and induces cellular senescence by stabilizing P53 through degradation of murine double minute 2 (MDM2).(PMID: 30804013,PMID: 33884955)