UFM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UFM1 Polyclonal antibody, PBS Only (15883-1-PBS)

• 

  WB analysis of mouse lung using 15883-1-AP (same clone as 15883-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 15883-1-AP (UFM1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15883-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15883-1-AP (same clone as 15883-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15883-1-AP (UFM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15883-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 15883-1-AP (same clone as 15883-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15883-1-AP (UFM1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15883-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 15883-1-AP (same clone as 15883-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15883-1-AP (UFM1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15883-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 15883-1-AP (same clone as 15883-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15883-1-AP (UFM1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15883-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 15883-1-AP (same clone as 15883-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15883-1-AP (UFM1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15883-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 15883-1-AP (same clone as 15883-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15883-1-AP (UFM1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15883-1-PBS in a different storage buffer formulation.

UFM1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15883-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Ubiquitin-fold modifier 1, ubiquitin fold modifier 1, C13orf20, BM-002, BM 002

---

Product Information

15883-1-PBS targets UFM1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8667

  Product name: Recombinant human UFM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of BC005193

  Sequence: MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC

• Full Name: ubiquitin-fold modifier 1
• Calculated Molecular Weight: 85 aa, 9 kDa
• Observed Molecular Weight: 9-12 kDa
• GenBank Accession Number: BC005193
• Gene Symbol: UFM1
• Gene ID (NCBI): 51569
• RRID: AB_2878195
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61960
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UFM1 (Ubiquitin-fold modifier 1) is a ubiquitin-like protein covalently conjugated with intracellular proteins through UFMylation (modification by UFM1), a process similar to ubiquitylation (PMID: 38141606). UFM1 is conjugated to its target proteins by E1-like activating enzyme UBE1DC1 and E2-like conjugating enzyme UFC1 in a manner analogous to ubiquitylation (PMID: 28234446; 33066455). At the molecular level, UFMylation is an important mediator of the protein function. Dysregulation of the UFM1 system, e.g., the knockout of UFMylation components, disturbs proteome homeostasis and triggers endoplasmic reticulum stress. Such changes are linked to developmental disorders, tumorigenesis, tissue injury, inflammation, and several hereditary neurological syndromes (PMID: 36932998). Western blot images showed that bands larger than 100kd may be proteins modified by UFM1.