UGDH Monoclonal antibody, PBS Only

• 

  WB analysis using 67360-1-Ig (same clone as 67360-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67360-1-Ig (UGDH antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67360-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67360-1-Ig (same clone as 67360-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67360-1-Ig (UGDH antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67360-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67360-1-Ig (same clone as 67360-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67360-1-Ig (UGDH antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67360-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67360-1-Ig (same clone as 67360-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67360-1-Ig (UGDH antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67360-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67360-1-Ig (same clone as 67360-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using UGDH antibody (67360-1-Ig, Clone: 1E2E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67360-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

UGDH Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67360-1-PBS

Clone No.1E2E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

UDP-GlcDH, UDP-Glc dehydrogenase, UDPGDH, GDH, EC:1.1.1.22

---

Product Information

67360-1-PBS targets UGDH in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29747

  Product name: Recombinant human UGDH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-301 aa of BC022781

  Sequence: MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQ

• Full Name: UDP-glucose dehydrogenase
• Calculated Molecular Weight: 494 aa, 55 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC022781
• Gene Symbol: UGDH
• Gene ID (NCBI): 7358
• RRID: AB_2882612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O60701
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UDP-glucose 6-dehydrogenase (UGDH) is a key enzyme in the uronic acid pathway, and converts UDP-glucose (UDP-Glc) to UDP-glucuronic acid (UDP-GlcA). UGDH is critical to the production of extracellular matrix components which are essential to the migration and connectivity of neurons early in human brain development. UDP-GlcA is an essential sugar nucleotide precursor and a key component in the synthesis and stepwise degradation of glycosaminoglycans (GAGs). The protein subunit migrates on SDS-PAGE at ~55 kDa. (PMID: 32175296, PMID: 21576248, PMID: 31243371).