VANGL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VANGL2 Polyclonal antibody, PBS Only (21492-1-PBS)

• 

  WB analysis using 21492-1-AP (same clone as 21492-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21492-1-AP (VANGL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21492-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21492-1-AP (same clone as 21492-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21492-1-AP (VANGL2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21492-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 21492-1-AP (same clone as 21492-1-PBS)

  IP result of anti-VANGL2 (IP:21492-1-AP, 4ug; Detection:21492-1-AP 1:500) with HepG2 cells lysate 1880 ug. This data was developed using the same antibody clone with 21492-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 21492-1-AP (same clone as 21492-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 21492-1-AP (VANGL2 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 21492-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 21492-1-AP (same clone as 21492-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 21492-1-AP (VANGL2 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 21492-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

VANGL2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 21492-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

KIAA1215, Loop tail protein 1 homolog, Loop-tail protein 1 homolog, LPP1, LTAP

---

Product Information

21492-1-PBS targets VANGL2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15833

  Product name: Recombinant human VANGL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 268-322 aa of BC103920

  Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ

• Full Name: vang-like 2 (van gogh, Drosophila)
• Calculated Molecular Weight: 521 aa, 60 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC103920
• Gene Symbol: VANGL2
• Gene ID (NCBI): 57216
• RRID: AB_11182263
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULK5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vangl2 is a key component of the planar cell polarity (PCP) pathway. Vangl2 is tightly associated with the postsynaptic density (PSD) fraction and forms a protein complex with PSD-95 and NMDA receptors. Vangl2 directly binds to the third PDZ domain of PSD-95 via its C-terminal TSV motif. Vangl2 directly binds to N-cadherin.