VEGF-C Recombinant monoclonal antibody

• 

  WB analysis using 83727-7-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83727-7-RR (VEGF-C antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 83727-7-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using VEGF-C antibody (83727-7-RR, Clone: 251992H1 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• 

  Affinity and Kinetic Characterization of 83727-7-RR

  Biolayer interferometry (BLl) kinetic assays of 83727-7-RR against Human VEGF-C were performed. The affinity constant is below 1 pM.

VEGF-C Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 83727-7-RR

Clone No.251992H1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

VEGFC, vascular endothelial growth factor C, Vascular endothelial growth factor-related protein, VEGF C

---

Tested Applications

• Positive WB detected in: MCF-7 cells, SW480 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83727-7-RR targets VEGF-C in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1482

  Product name: Recombinant human VEGFC protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 112-227 aa of BC035212

  Sequence: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

• Full Name: vascular endothelial growth factor C
• Calculated Molecular Weight: 419 aa, 47 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC035212
• Gene Symbol: VEGFC
• Gene ID (NCBI): 7424
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49767
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VEGFC is a member of the platelet-derived growth factor / vascular endothelial growth factor (PDGF/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration.