CoraLite® Plus 488-conjugated VEGF-C Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated VEGF-C Recombinant monoclonal antibody (CL488-83727-7)

VEGF-C Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83727-7

Clone No.251992H1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

VEGFC, vascular endothelial growth factor C, Vascular endothelial growth factor-related protein, VEGF C

• 

  IF Staining of MCF-7 using CL488-83727-7

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CoraLite® Plus 488 VEGF-C antibody (CL488-83727-7, Clone: 251992H1 ) at dilution of 1:200.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83727-7 targets VEGF-C in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1482

  Product name: Recombinant human VEGFC protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 112-227 aa of BC035212

  Sequence: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

• Full Name: vascular endothelial growth factor C
• Calculated Molecular Weight: 419 aa, 47 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC035212
• Gene Symbol: VEGFC
• Gene ID (NCBI): 7424
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49767
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

VEGFC is a member of the platelet-derived growth factor / vascular endothelial growth factor (PDGF/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration.