VGLL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VGLL1 Polyclonal antibody, PBS Only (10124-2-PBS)

• 

  WB analysis using 10124-2-AP (same clone as 10124-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10124-2-AP (VGLL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10124-2-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 10124-2-AP (same clone as 10124-2-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10124-2-AP (VGLL1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10124-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 10124-2-AP (same clone as 10124-2-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10124-2-AP (VGLL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10124-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10124-2-AP (same clone as 10124-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10124-2-AP (VGLL1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10124-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

VGLL1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10124-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10124-2-PBS targets VGLL1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0169

  Product name: Recombinant human VGLL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 38-255 aa of BC000045

  Sequence: SSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTSSLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGHPHRYL

• Full Name: vestigial like 1 (Drosophila)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 26-29 kDa
• GenBank Accession Number: BC000045
• Gene Symbol: VGLL1
• Gene ID (NCBI): 51442
• RRID: AB_2218174
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99990
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VGLL1 is a specific coactivator for the mammalian TEFs. It can bind proteins of the TEA domain family of transcription factors. Vgll1-TEFs complex upregulates the expression of IGFBP-5, a proliferation-promoting gene, and facilitates anchorage-independent cell proliferation. The calculated molecular weight of VGLL1 is 29 kDa, and the observed molecular weight is 26-29 kDa(PMID:31816819,33087697).