VNN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VNN2 Polyclonal antibody, PBS Only (25643-1-PBS)

• 

  WB analysis of HeLa using 25643-1-AP (same clone as 25643-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25643-1-AP (VNN2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25643-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 25643-1-AP (same clone as 25643-1-PBS)

  Immunofluorescent analysis of HeLa cells using 25643-1-AP (VNN2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25643-1-PBS in a different storage buffer formulation.

VNN2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25643-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25643-1-PBS targets VNN2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22345

  Product name: Recombinant human VNN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 448-520 aa of BC126145

  Sequence: EIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSSCGTSNSAITYLLIFILLMIIALQNIVML

• Full Name: vanin 2
• Calculated Molecular Weight: 520 aa, 59 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC126145
• Gene Symbol: VNN2
• Gene ID (NCBI): 8875
• RRID: AB_2880173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95498
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.