VPS13D Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VPS13D Polyclonal antibody, PBS Only (29387-1-PBS)

• 

  WB analysis using 29387-1-AP (same clone as 29387-1-PBS)

  HeLa cells were subjected to Tris-Acetate gel system followed by western blot with 29387-1-AP (VPS13D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29387-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 29387-1-AP (same clone as 29387-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 29387-1-AP (VPS13D antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29387-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 29387-1-AP (same clone as 29387-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using VPS13D antibody (29387-1-AP) at dilution of 1:200 and Cy3-conjugated Affinipure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29387-1-PBS in a different storage buffer formulation.

VPS13D Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29387-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Intermembrane lipid transfer protein VPS13D, KIAA0453, Vacuolar protein sorting-associated protein 13D

---

Product Information

29387-1-PBS targets VPS13D in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29933

  Product name: Recombinant human VPS13D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4202-4388 aa of NM_015378

  Sequence: DFASETAQAVRDTATLSGPRTQAQRVRKPRCCTGPQGLLPRYSESQAEGQEQLFKLTDNIQDEFFIAVENIDSYCVLISSKAVYFLKSGDYVDREAIFLEVKYDDLYHCLVSKDHGKVYVQVTKKAVSTSSGVSIPGPSHQKPMVHVKSEVLAVKLSQEINYAKSLYYEQQLMLRLSENREQLELDS

• Full Name: vacuolar protein sorting 13 homolog D (S. cerevisiae)
• Calculated Molecular Weight: 492 kDa
• Observed Molecular Weight: ~500 kDa
• GenBank Accession Number: NM_015378
• Gene Symbol: VPS13D
• Gene ID (NCBI): 55187
• RRID: AB_3086126
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5THJ4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VPS13 (vacuolar protein sorting 13 ) acts at membrane contact sites between intracellular organelles to transport lipids. There are four VPS13 family members in human - VPS13A, VPS13B, VPS13C and VPS13D. Mutations in human VPS13 genes are linked to rare neurodegenerative disorders: chorea- acanthocytosis (VPS13A), Cohen syndrome (VPS13B), predispose to early onset into Parkinson disease (VPS13C) and lead to ataxia/spastic paraplegia (VPS13D) (PMID: 30656912).