CoraLite® Plus 488-conjugated VPS25 Monoclonal antibody

VPS25 Monoclonal Antibody for IF/ICC
Cat No. CL488-68197
Clone No.3B4C3

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rabbit

Applications

IF/ICC

DERP9, EAP20, ESCRT II complex subunit VPS25, FAP20, hVps25, VPS25

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68197 targets VPS25 in IF/ICC applications and shows reactivity with Human, Rabbit samples.

Tested Reactivity Human, Rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8243

Product name: Recombinant human VPS25 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-176 aa of BC006282

Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

Predict reactive species
Full Name vacuolar protein sorting 25 homolog (S. cerevisiae)
Calculated Molecular Weight 176 aa, 21 kDa
Observed Molecular Weight19 kDa
GenBank Accession NumberBC006282
Gene Symbol VPS25
Gene ID (NCBI) 84313
RRIDAB_3084438
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BRG1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

VPS25 is a component of the endosome-associated complex ESCRT-II (Endosomal Sorting Complexes Required for Transport protein II). ESCRT-II complex, composed of VPS25, VPS36, and SNF8, functions in sorting of ubiquitinated membrane proteins during endocytosis. ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. VPS25 is highly conserved. Human VPS25 gene maps to chromosome 17q21.31 and is expressed in a wide range of tissues (PMID: 16889659).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 VPS25 antibody CL488-68197Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...