ValRS Monoclonal antibody

• 

  WB analysis using 67935-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67935-1-Ig (ValRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with Lamin B1 Monoclonal antibody (66095-1-Ig) as loading control.

• 

  WB analysis of HepG2 using 67935-1-Ig

  WB result of ValRS antibody (67935-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ValRS transfected HepG2 cells.

• 

  WB analysis of LNCaP using 67935-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67935-1-Ig (ValRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 67935-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67935-1-Ig (ValRS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 67935-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67935-1-Ig (ValRS antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 67935-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using ValRS antibody (67935-1-Ig, Clone: 1A2C3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

ValRS Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67935-1-Ig

Clone No.1A2C3

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

G7A, Protein G7a, Valine tRNA ligase, ValRS, valyl tRNA synthetase, VARS, VARS1, VARS2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, LNCaP cells, MCF-7 cells, HeLa cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67935-1-Ig targets ValRS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9312

  Product name: Recombinant human VARS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 916-1264 aa of BC012808

  Sequence: ECGTDALRFGLCAYMSQGRDINLDVNRILGYRHFCNKLWNATKFALRGLGKGFVPSPTSQPGGHESLVDRWIRSRLTEAVRLSNQGFQAYDFPAVTTAQYSFWLYELCDVYLECLKPVLNGVDQVAAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRMPQAPPSLCVTPYPEPSECSWKDPEAEAALELALSITRAVRSLRADYNLTRIRPDCFLEVADEATGALASAVSGYVQALASAGVVAVLALGAPAPQGCAVALASDRCSIHLQLQGLVDPARELGKLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML

• Full Name: valyl-tRNA synthetase
• Calculated Molecular Weight: 1264 aa, 140 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC012808
• Gene Symbol: ValRS
• Gene ID (NCBI): 7407
• RRID: AB_2918687
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P26640
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.