CoraLite® Plus 647-conjugated WASF3 Monoclonal antibody

WASF3 Monoclonal Antibody for IF-P
Cat No. CL647-67620
Clone No.3B7D10

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig, Rabbit

Applications

IF-P

Brush 1, KIAA0900, Protein WAVE 3, SCAR3, WAS protein family, member 3, WASF3, WASP family protein member 3, WAVE3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-67620 targets WASF3 in IF-P applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.

Tested Reactivity Human, Mouse, Rat, Pig, Rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29991

Product name: Recombinant human WASF3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 212-391 aa of BC050283

Sequence: GIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTA

Predict reactive species
Full Name WAS protein family, member 3
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 50-55 and 66-70 kDa
GenBank Accession NumberBC050283
Gene Symbol WASF3
Gene ID (NCBI) 10810
RRIDAB_3084825
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UPY6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

WASF3, also named as WAVE3 or SCAR3, belongs to the SCAR/WAVE family. It plays a role in the regulation of cell morphology and cytoskeletal organization. WASF3 is associated with the movement, invasion and metastasis in different cancers such as breast cancer, gastric cancer and prostate cancer. It has been shown that WASF3 levels are elevated in advanced stage cancers compared to lower grade tumors and normal tissue. 67620-1-Ig antibody recognizes 50-55 kDa and 66-70 kDa protein similar to the papers.(PMID: 21544801, 15826941, 31038356, 27432794, 31542393)

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 WASF3 antibody CL647-67620Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...