WDR35 Polyclonal antibody

• 

  IF Staining of MDCK using 26701-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MDCK cells using WDR35 antibody (26701-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite® Plus 488 ARL13B antibody (CL488-17711, green).

• 

  IF Staining of hTERT-RPE1 using 26701-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using WDR35 antibody (26701-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite® Plus 488 ARL13B antibody (CL488-17711, green).

WDR35 Polyclonal Antibody for IF/ICC, ELISA

Cat No. 26701-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, canine

Applications

IF/ICC, ELISA

Synonyms

IFT121, Intraflagellar transport protein 121 homolog, KIAA1336, WD repeat domain 35, WD repeat-containing protein 35

---

Tested Applications

• Positive IF/ICC detected in: MDCK cells, hTERT-RPE1 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26701-1-AP targets WDR35 in IF/ICC, ELISA applications and shows reactivity with human, canine samples.

• Tested Reactivity: human, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24965

  Product name: Recombinant human WDR35 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 822-1170 aa of BC036659

  Sequence: AECYYMLEDYEGLENLAISLPENHKLLPEIAQMFVRVGMCEQAVTTFLKCSQPKAAVDTCVHLNQWNKAVELAKNHSMKEIGSLLARYASHLLEKNKTLDAIELYRKANYFFDAAKLMFKIADEEAKKGSKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKGKSSEATSALAGLLEEEVLSTTDRFTDNAWRGAEAYHFFILAQRQLYEGCVDTALKTALHLKDYEDIIPPVEIYSLLALCACAGRAFGTCSKAFIKLKSLETLSSEQKQQYEDLALEIFTKHTSKDNRKPELDSLMEGGEGKLPTCVATGSPITEYQFWMCSVCKHGVLAQEISHYSFCPLCHSPVG

• Full Name: WD repeat domain 35
• Calculated Molecular Weight: 1170 aa, 132 kDa
• GenBank Accession Number: BC036659
• Gene Symbol: WDR35
• Gene ID (NCBI): 57539
• RRID: AB_3085893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2L0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WDR35, a component of the IFT complex A (IFT-A), is required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs). It is involved in ciliogenesis and ciliary protein trafficking (PMID:21473986, PMID:28400947, PMID:29220510). It may promote CASP3 activation and TNF-stimulated apoptosis (PMID: 20193664).