WDR35 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WDR35 Polyclonal antibody, PBS Only (26701-1-PBS)

• 

  IF Staining of MDCK using 26701-1-AP (same clone as 26701-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MDCK cells using WDR35 antibody (26701-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite® Plus 488 ARL13B antibody (CL488-17711, green). This data was developed using the same antibody clone with 26701-1-PBS in a different storage buffer formulation.

• 

  IF Staining of hTERT-RPE1 using 26701-1-AP (same clone as 26701-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using WDR35 antibody (26701-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite® Plus 488 ARL13B antibody (CL488-17711, green). This data was developed using the same antibody clone with 26701-1-PBS in a different storage buffer formulation.

WDR35 Polyclonal Antibody for IF/ICC, Indirect ELISA

Cat No. 26701-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, canine

Applications

IF/ICC, Indirect ELISA

Synonyms

---

Product Information

26701-1-PBS targets WDR35 in IF/ICC, Indirect ELISA applications and shows reactivity with human, canine samples.

• Tested Reactivity: human, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24965

  Product name: Recombinant human WDR35 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 822-1170 aa of BC036659

  Sequence: AECYYMLEDYEGLENLAISLPENHKLLPEIAQMFVRVGMCEQAVTTFLKCSQPKAAVDTCVHLNQWNKAVELAKNHSMKEIGSLLARYASHLLEKNKTLDAIELYRKANYFFDAAKLMFKIADEEAKKGSKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKGKSSEATSALAGLLEEEVLSTTDRFTDNAWRGAEAYHFFILAQRQLYEGCVDTALKTALHLKDYEDIIPPVEIYSLLALCACAGRAFGTCSKAFIKLKSLETLSSEQKQQYEDLALEIFTKHTSKDNRKPELDSLMEGGEGKLPTCVATGSPITEYQFWMCSVCKHGVLAQEISHYSFCPLCHSPVG

• Full Name: WD repeat domain 35
• Calculated Molecular Weight: 1170 aa, 132 kDa
• GenBank Accession Number: BC036659
• Gene Symbol: WDR35
• Gene ID (NCBI): 57539
• RRID: AB_3085893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2L0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WDR35, a component of the IFT complex A (IFT-A), is required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs). It is involved in ciliogenesis and ciliary protein trafficking (PMID:21473986, PMID:28400947, PMID:29220510). It may promote CASP3 activation and TNF-stimulated apoptosis (PMID: 20193664).