WDR43 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WDR43 Polyclonal antibody, PBS Only (30227-1-PBS)

• 

  WB analysis using 30227-1-AP (same clone as 30227-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30227-1-AP (WDR43 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30227-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 30227-1-AP (same clone as 30227-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 30227-1-AP (WDR43 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30227-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 30227-1-AP (same clone as 30227-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 30227-1-AP (WDR43 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30227-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 30227-1-AP (same clone as 30227-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 30227-1-AP (WDR43 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30227-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat ovary using 30227-1-AP (same clone as 30227-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 30227-1-AP (WDR43 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30227-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30227-1-AP (same clone as 30227-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using WDR43 antibody (30227-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 30227-1-PBS in a different storage buffer formulation.

WDR43 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30227-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

KIAA0007, WD repeat domain 43

---

Product Information

30227-1-PBS targets WDR43 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30585

  Product name: Recombinant human WDR43 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-150 aa of NM_015131

  Sequence: MAAGGGGSCDPLAPAGVPCAFSPHSQAYFALASTDGHLRVWETANNRLHQEYVPSAHLSGTCTCLAWAPARLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKLISGGHDNRVNCIQWHQDSGCLYSCSDDKHI

• Full Name: WD repeat domain 43
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_015131
• Gene Symbol: WDR43
• Gene ID (NCBI): 23160
• RRID: AB_3086268
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15061
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WDR43, a WD40 domain-containing protein, is a conserved component of the small-subunit processome (SSUP), which mediates pre-18S ribosomal RNA (rRNA) transcription and processing in the nucleolus and is critical for ribosome biogenesis in yeast. Its mutation in zebrafish causes a variety of early developmental defects in specific tissues. WDR43 directly promotes ESC self-renewal by maintaining high-level expression of its target genes involved in pluripotency programs. (PMID: 28880863, 24497835, 31128943)