WDR82 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WDR82 Polyclonal antibody, PBS Only (21354-1-PBS)

• 

  WB analysis of HL-60 using 21354-1-AP (same clone as 21354-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 21354-1-AP (WDR82 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21354-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21354-1-AP (same clone as 21354-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21354-1-AP (WDR82 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21354-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 21354-1-AP (same clone as 21354-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21354-1-AP (WDR82 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21354-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 21354-1-AP (same clone as 21354-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21354-1-AP (WDR82 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21354-1-PBS in a different storage buffer formulation.

WDR82 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21354-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

21354-1-PBS targets WDR82 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15762

  Product name: Recombinant human WDR82 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 175-313 aa of BC018941

  Sequence: DLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD

• Full Name: WD repeat domain 82
• Calculated Molecular Weight: 313 aa, 35 kDa
• Observed Molecular Weight: 33-35 kDa
• GenBank Accession Number: BC018941
• Gene Symbol: WDR82
• Gene ID (NCBI): 80335
• RRID: AB_3085654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXN9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.