WFDC12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WFDC12 Polyclonal antibody, PBS Only (25101-1-PBS)

• 

  IHC staining of human lung cancer using 25101-1-AP (same clone as 25101-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25101-1-AP (WFDC12 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25101-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 25101-1-AP (same clone as 25101-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25101-1-AP (WFDC12 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25101-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 25101-1-AP (same clone as 25101-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25101-1-AP (WFDC12 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25101-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 25101-1-AP (same clone as 25101-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25101-1-AP (WFDC12 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25101-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

WFDC12 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25101-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

25101-1-PBS targets WFDC12 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18795

  Product name: Recombinant human WFDC12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-111 aa of BC146514

  Sequence: CPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK

• Full Name: WAP four-disulfide core domain 12
• Calculated Molecular Weight: 111 aa, 12 kDa
• GenBank Accession Number: BC146514
• Gene Symbol: WFDC12
• Gene ID (NCBI): 128488
• RRID: AB_2879897
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWY7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.