WNK1 Monoclonal antibody

WNK1 Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 68149-1-Ig
Clone No.1B6A10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

1B6A10, EC:2.7.11.1, HSAN2, HSN2, KDP

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, A549 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells
Positive FC (Intra) detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68149-1-Ig targets WNK1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28044

Product name: Recombinant human WNK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-209 aa of BC021121

Sequence: MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELET

Predict reactive species
Full Name WNK lysine deficient protein kinase 1
Calculated Molecular Weight 251 kDa
Observed Molecular Weight250 kDa
GenBank Accession NumberBC021121
Gene Symbol WNK1
Gene ID (NCBI) 65125
RRIDAB_2923673
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H4A3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WNK kinase is a unique serine-threonine kinase in which the lysine (K) residue in the catalytic domain, that is found in the majority of kinases is not conserved. In mammals, there are four WNK kinase family members (WNK1-4). WNK1 has 6 isoforms, such as long form WNK1 (L-WNK1, 250 kDa, strong expression in dorsal root ganglia and spinal cord) ; kidney-specific isoform (KS-WNK1, 207 kDa, lacks a kinase domain).KS-WNK1 cannot phosphorylate substrates and instead interacts with and modulates the actions of other WNKs via a carboxyl terminal HQ domain.

Protocols

Product Specific Protocols
WB protocol for WNK1 antibody 68149-1-IgDownload protocol
FC protocol for WNK1 antibody 68149-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...