• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated WNT10B Monoclonal antibody

WNT10B Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67210
Clone No.1G11E4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC, FC (Intra)

Protein Wnt 10b, Protein Wnt 12, SHFM6, WNT 12, WNT10B, WNT12

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67210 targets WNT10B in IF/ICC, FC (Intra) applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17114

Product name: Recombinant human WNT10B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 19-204 aa of BC096353

Sequence: FLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMD

Predict reactive species
Full Name wingless-type MMTV integration site family, member 10B
Calculated Molecular Weight 389 aa, 43 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC096353
Gene Symbol WNT10B
Gene ID (NCBI) 7480
RRIDAB_2923765
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO00744
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Wnt10b is a member of the Wnt ligand gene family that encodes for secreted proteins, which activate the ancient and highly conserved Wnt signalling cascade. This antibody can be detected a band of 43 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 WNT10B antibody CL488-67210Download protocol
FC protocol for CL Plus 488 WNT10B antibody CL488-67210Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...