WWP2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• WWP2 Monoclonal antibody (67274-1-Ig)

WWP2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67274-1-Ig Copied!

Clone No. 2C9B4

Publications (4)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

AIP2, WW domain containing protein 2, WWP2, WWp2 like

• 

  WB analysis using 67274-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67274-1-Ig (WWP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 67274-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67274-1-Ig (WWP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 67274-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67274-1-Ig (WWP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for WWP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, LNCap cells, MCF-7 cells, K-562 cells, HSC-T6 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67274-1-Ig targets WWP2 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Rat samples.

• Tested Reactivity: Human, Rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2835

  Product name: Recombinant human WWP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC013645

  Sequence: MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRT

• Full Name: WW domain containing E3 ubiquitin protein ligase 2
• Calculated Molecular Weight: 870 aa, 99 kDa
• Observed Molecular Weight: 100-115 kDa
• GenBank Accession Number: BC013645
• Gene Symbol: WWP2
• Gene ID (NCBI): 11060
• RRID: AB_2882543
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00308
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WWP2 (WW domain-containing protein 2) is also named as AIP2 and belongs to the NEDD4-like protein family. It functions as an E3 ubiquitin ligase for PTEN that plays a vital role in tumour-cell survival and is also involved in regulating transcription, embryonic stem-cell fate, cellular transport and T-cell activation processes (PMID:21532586). WWP2, which specifically interacted with ES cell-specific transcription factor Oct-4 and promoted its ubiquitination both in vitro and in vivo, is a ubiquitously expressed protein and exists in both cytoplasmic and nuclear compartments in ES cells (PMID:15047715).

Publications

What published studies show

The WWP2 Monoclonal antibody (Cat# 67274-1-Ig) has 4 citations. These appear in the Journal of Experimental & Clinical Cancer Research, Journal of Translational Medicine, International Journal of Biological Macromolecules, and British Journal of Pharmacology. The research fields span cancer biology, including gastric cancer, lung adenocarcinoma, bladder cancer, and non-small cell lung cancer, with studies focused on ubiquitination, signaling pathways (AKT, Hippo, STAT3), drug resistance, and mitochondrial dysfunction. Applications include Western blot and immunofluorescence.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Exp Clin Cancer Res; PHB2 promotes SHIP2 ubiquitination via the E3 ligase NEDD4 to regulate AKT signaling in gastric cancer; Authors - Liang Xu
human	IF	J Transl Med; FAM189A2 activates Hippo signaling pathway by abrogating WWP2-mediated LATS1 ubiquitination, to inhibit the glycolysis and proliferation processes of lung adenocarcinoma.; Authors - Bingyu Chen
		Int J Biol Macromol; Targeting the WWP2-ASPP2 axis overcomes cisplatin resistance by inhibiting the mevalonate pathway in TP53-mutant bladder cancer.; Authors - Qixiang Fang
human	WB	Br J Pharmacol; Sculponeatin A induces mitochondrial dysfunction in non-small cell lung cancer through WWP2-mediated degradation of mitochondrial STAT3; Authors - Fang Wan