WWP2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67274-1-Ig (same clone as 67274-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67274-1-Ig (WWP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67274-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 67274-1-Ig (same clone as 67274-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67274-1-Ig (WWP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67274-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 67274-1-Ig (same clone as 67274-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67274-1-Ig (WWP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67274-1-PBS in a different storage buffer formulation.

WWP2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67274-1-PBS

Clone No.2C9B4

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat

Applications

WB, IHC, Indirect ELISA

Synonyms

AIP2, WW domain containing protein 2, WWP2, WWp2 like

---

Product Information

67274-1-PBS targets WWP2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Rat samples.

• Tested Reactivity: Human, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2835

  Product name: Recombinant human WWP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC013645

  Sequence: MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRT

• Full Name: WW domain containing E3 ubiquitin protein ligase 2
• Calculated Molecular Weight: 870 aa, 99 kDa
• Observed Molecular Weight: 100-115 kDa
• GenBank Accession Number: BC013645
• Gene Symbol: WWP2
• Gene ID (NCBI): 11060
• RRID: AB_2882543
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00308
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WWP2 (WW domain-containing protein 2) is also named as AIP2 and belongs to the NEDD4-like protein family. It functions as an E3 ubiquitin ligase for PTEN that plays a vital role in tumour-cell survival and is also involved in regulating transcription, embryonic stem-cell fate, cellular transport and T-cell activation processes (PMID:21532586). WWP2, which specifically interacted with ES cell-specific transcription factor Oct-4 and promoted its ubiquitination both in vitro and in vivo, is a ubiquitously expressed protein and exists in both cytoplasmic and nuclear compartments in ES cells (PMID:15047715).