FRMD6/Willin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FRMD6/Willin Polyclonal antibody, PBS Only (21039-1-PBS)

• 

  WB analysis using 21039-1-AP (same clone as 21039-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21039-1-AP (Willin antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 21039-1-AP (same clone as 21039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 21039-1-AP (Willin antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 21039-1-AP (same clone as 21039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 21039-1-AP (Willin antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21039-1-AP (same clone as 21039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 21039-1-AP (Willin antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21039-1-AP (same clone as 21039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 21039-1-AP (Willin antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21039-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 21039-1-AP (same clone as 21039-1-PBS)

  1X10^6 A431 cells were stained with .2ug Willin antibody (21039-1-AP, red) and control antibody (blue). Fixed with 4% PFA blocked with 3% BSA (30 min). Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L) with dilution 1:1500. This data was developed using the same antibody clone with 21039-1-PBS in a different storage buffer formulation.

FRMD6/Willin Polyclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 21039-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

FRMD6, Willin, EX1, FERM domain containing 6, FERM domain-containing protein 6

---

Product Information

21039-1-PBS targets FRMD6/Willin in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15375

  Product name: Recombinant human Willin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-266 aa of BC029870

  Sequence: LDMDQLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRKLKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFPVKRTSKYFSLDLTHDEVPEFVV

• Full Name: FERM domain containing 6
• Calculated Molecular Weight: 622 aa, 72 kDa
• Observed Molecular Weight: 72, 70, 30 kDa
• GenBank Accession Number: BC029870
• Gene Symbol: FRMD6/Willin
• Gene ID (NCBI): 122786
• RRID: AB_2878797
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96NE9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Willin, also known as FRMD6 or human Expanded (hEx), is a member of the FERM-domain family of cytoskeletal crosslinkers. It is a potent inhibitor of cell proliferation, transformation and modulator of drug sensitivity, suggesting it possesses tumor suppressor properties. Willin is widely expressed in normal tissues. Although willin is found in the cytoplasm and membrane, it localizes to the nuclei of almost all tumors.This antibody was raised against the C-terminal region of human FRMD6 protein and is expected to recognize the endogenous FRMD6.